SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007625 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007625
Domain Number 1 Region: 400-471
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.71e-20
Family Intermediate filament protein, coiled coil region 0.00046
Further Details:      
 
Domain Number 2 Region: 159-194
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000335
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007625
Domain Number - Region: 198-271
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00183
Family Intermediate filament protein, coiled coil region 0.019
Further Details:      
 
Domain Number - Region: 298-450
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0424
Family FCH domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007625   Gene: ENSMPUG00000007680   Transcript: ENSMPUT00000007746
Sequence length 530
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897098.1:2709832:2733970:1 gene:ENSMPUG00000007680 transcript:ENSMPUT00000007746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGAGGGAGTSHHLTGWSGWEASRPPGANEHCRTGVCSSVPSLPCLRPEPAACHPSKAHS
HTHTHTPVPSRVPGPGAAMACRSCVVGFSSLSSCEVTPAGGPRPGTSGWGICGTPGPGFS
SRSLTGCEAAGTIAKVTVNPSLLVPLDLKVDPAIQQQKNQEKEEMKVLNDKFASLIGKVQ
ALEQRNQLLETRWHFLQGQDSGTFDLGHLYEGYQARLQEELRKVNQERGQLEASLLQVLQ
KVEEFRIRYEEEISKRTDMEFTFVQLKKDLDAECLRRTELETKLKGLQSFVELMKNIYEQ
ELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKLQYDAIAARSLEEAEAYSRRQLEERA
ACSAEFGNSLQSSRSEIADLNVRIQKLRSQILSIKSHCLKLEENIKAAEEQGELAFQDAK
AKLAQLEDALQQAKKDMALQLREYQELMNTKLALDIEIATYRKLVEGEESRMDLPSASMV
SMVQSRSRTAASKPSLSRAPSRKKKNRKGPVIKITEMSEKFLLQESEVSE
Download sequence
Identical sequences M3Y8G8
ENSMPUP00000007625 ENSMPUP00000007625 XP_004774755.2.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]