SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007711 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007711
Domain Number 1 Region: 189-284
Classification Level Classification E-value
Superfamily SAND domain-like 1.36e-41
Family SMAD4-binding domain of oncoprotein Ski 0.00000102
Further Details:      
 
Domain Number 2 Region: 60-163
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.2e-39
Family Dachshund-homology domain 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007711   Gene: ENSMPUG00000007768   Transcript: ENSMPUT00000007835
Sequence length 680
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897035.1:5714946:5777703:-1 gene:ENSMPUG00000007768 transcript:ENSMPUT00000007835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLGGPAAFSARWAQEAYKKESAKEASATAVPAPVPAAAEPPPVLHLPAIQPPPPVLPG
PFFMPSDRSTERCETVLEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQINSVCDELHI
YCSRCTADQLEILKVMGILPFSAPSCGLITKTDAERLCNALLYGGAYPPPCKKELAASLA
LGLELSERSVRVYHECFGKCKGLLVPELYSSPSAACIQCLDCRLMYPPHKFVVHSHKALE
NRTCHWGFDSANWRAYILLSQDYTGKEEQARLGRCLDDVKEKFDYGNKYKRRVPRVSSEP
PASIRKTDDASAQLPTSSEKDKQSGWLRPLASSSSKSLGCVHPRQRLSAFRPWSPAVSTS
DKELSPHLPALIRDSFYSYKSFETGVAPNVALAPPAQQKVVSSPPCTAVVSRAPEPLATC
LQPRKRKLTVDTPGAPETPAPVAVAAPEDDKDSEAEVEVDSREECAFTSSLSSLSSPSLT
SSSSAKDLSSPGVHAPPAAPAAPEAVAPADPTSGGLEAELEHLRQALEGGLDTKEAKEKF
LHEVVKMRVKQEEKLSAALQAKRGLHQELEFLRVAKKEKLREATEAKRNLRKEIERLRAE
NEKKMREANESRLRLKRELEQARQVRVCDKGCEAGRLRAKYSAQVRAGGLGAGVGGAXXX
XXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences M3Y8Q4
ENSMPUP00000007711 ENSMPUP00000007711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]