SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008128 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008128
Domain Number 1 Region: 139-254
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.14e-23
Family Voltage-gated potassium channels 0.0029
Further Details:      
 
Domain Number 2 Region: 5-31,71-139
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-23
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008128   Gene: ENSMPUG00000008188   Transcript: ENSMPUT00000008257
Sequence length 357
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897286.1:62427:97701:-1 gene:ENSMPUG00000008188 transcript:ENSMPUT00000008257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQQELRARYNLSQGGYEELE
RVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLTLV
MFQSLGERINTFVKYLLHRAKRGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSYYEH
WTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLNLVV
LRFMTMNAEDEKRDAERGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSD
TCVEQSHSSPGGGGRYSDTPSHRCLCSGAQRSAISSVSTGLHSLSTFRGLMKRRSSV
Download sequence
Identical sequences M3Y9X1
ENSMPUP00000008128 ENSMPUP00000008128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]