SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008396 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008396
Domain Number 1 Region: 56-116
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-26
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 206-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 360-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 169-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.49e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008396   Gene: ENSMPUG00000008460   Transcript: ENSMPUT00000008531
Sequence length 420
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897062.1:4198877:4219325:-1 gene:ENSMPUG00000008460 transcript:ENSMPUT00000008531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGGEERRSVRVLCLSHRMAAVVLSPTCAQPSLFSASPQKGCTEEEGSVHGFLTSWLPDL
VTFEDVAVEFTQEEWALLDPSQRTLYRDVMRENCRNLASLGYHVDKPSLISQLEQEDKVV
TEERGVLPGTCPDLDTVLKAKWLTPKKHDFRKEHSSGIKAERNHLGVKLNECNQCFKVFS
TKSNLTQHKRIHTGEKPYDCNQCGKSFSSRSYLTIHKRIHNGEKPYECNDCGKAFNDPSS
LRLHVRIHTGEKPYECNQCFHVFRTSCNLKSHKRIHTRENHHECNQCGKAFSTRSSLTGH
NSIHTGEKPYECHNCGKTFRKSSYLTQHMRTHTGEKPYECNQCGKSFSSSFSLTVHKRIH
TGEKPYECSNCGKAFNNLSAVKKHVRTHTGEKPYECNHCGKSFTTNSYLSVHKRIHNRWI
Download sequence
Identical sequences M3YAN9
ENSMPUP00000008396 ENSMPUP00000008396 XP_004771791.1.14098 XP_012900726.1.14098 XP_012900727.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]