SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008611 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008611
Domain Number 1 Region: 8-207
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000000159
Family BAR domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008611   Gene: ENSMPUG00000008680   Transcript: ENSMPUT00000008752
Sequence length 290
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896939.1:3626759:3633763:1 gene:ENSMPUG00000008680 transcript:ENSMPUT00000008752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGPVLPRDSQVRVMENTVTNAEKYFGQFCSLLAAYTRKTARLRDKADQLVRQLTDFANTE
NPEMRATMRNFAEDLAKVQDYRQAEVERLETKVICPLKLYGAHIKQTRAEIKKFKQVQKN
EMKQLEKLEKLRQKSPSDRQMISQAETGVQRASVDASRITHQLEEVIDTFQKQKLKDLQK
IFSDFVTIEMVFHAKAVEVYSSAFQILESYDLERDLEDFRTKMHGVYGRYDARPFKDTTP
SPAVPWALTGQSTQTTIRSQRDEEEEESTEHSAEEDPVEDLRGQGRAPQQ
Download sequence
Identical sequences M3YBA4
ENSMPUP00000008611 ENSMPUP00000008611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]