SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008765 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008765
Domain Number 1 Region: 178-234
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.21e-18
Family PHD domain 0.002
Further Details:      
 
Domain Number 2 Region: 106-156
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000707
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 1572-1622
Classification Level Classification E-value
Superfamily SH3-domain 0.000000761
Family SH3-domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008765
Domain Number - Region: 1680-1739
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00481
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008765   Gene: ENSMPUG00000008835   Transcript: ENSMPUT00000008909
Sequence length 1766
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897275.1:355093:461146:1 gene:ENSMPUG00000008835 transcript:ENSMPUT00000008909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDDSLDELVDRSPGPAGRRRLSPAALASSAEESSDGAGGGSEDDTGSERSCSTDGADED
GGLEDPSGSEDSEEEGGRGEGAEALVAVVDAQGKLEASGAFSSDDDSESCPICLNTFRDQ
AVGTPENCAHYFCLDCIVEWSKNANSCPVDRTVFKCICIRARLGGKILKKIPVENARAGE
DEEEDPTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPECAAPGAAP
AADAGPVSEEEVSLLLADVVPTTSRLRPHAGRTRAIARTRQSERVRATVNRNRISTARRI
QHVPRHLVSSLLDETIEAVAAGLSSAVYQRPVTPRAAAKRRRRVGRRRKVSGRRKTQSRS
SVKSRSSGTRSKKRQGRVRKRKGKKSKNEATARSRIARTLGLRGPARGACIPSVHKPADP
SLGLMRADIGVASLSLFGDPYELDPFDSSEEPSANPASPLSAKRRVLSQSALRSHRPVAR
PVAVGLSRRSVPAAAPEPEVDEAPVPDLVGSILSGQSLLMMNGADIVIHRDGSLSAKSAA
PVSFPRSTGGSSQGAEHRGPRACLQPRAPHSGSGPQGAGLSCRGGPAPSRVPALRTGATV
RLDPSVTPLSGQTQNLSGVRGPGLKQRDDTRWDSDSRRALLPSSASSKTPSSCCHLPPAG
ALLGQALKPAPRRPDISELPRIPKVRREGGGGQTDAAPASEQRAEIPSSCISRLTGREGP
GQPGHGARAEGEPSHRGPQDPGPHSGGGSQSPASLGPSKGKGVSSTFESFRINIPGNTAH
SGRLSNPGFCNTFRPVDNKVQRKEAPSPLFSIRKTKQLKSEIYDPFDPTGSDSSSAGSSP
ERLGSGLLPSEITRTISINSPKAPMLQTVRCVTSYTVETVLGTEPEPPRGPSSSGLELRG
EGAAEGTSDLECEGLREGLGEGQGSASRAQRPSPPEPWEDKGQLPCSTFFGSEERMVTCV
TVAEPEAPPSPDAPQMTTHRIVELRSPSCSRSTSSSRGGKKAKRKRATSREHRRTRSGSR
SGSRSGDRSSRSVSPPVGDDHPRRQQTKSRGRRSSSDHSSSHERAKRKKTKDERRRKTDS
RGHGRRRSRSRSGSPCSSSHERRESRRRKRRRSGSRSRGRECSPPSSLERARRHRHPRER
SPRERSRERPRTRWGSHERRKRRSRSPRSPSTEHRSREHQRPRSHERRPRPRSPERKLAP
VLQEEQKPDQELPARPLAPAGADASPAGAETHKVAPEAPAGHPPEDLDYGDSVEAGHIFE
DFSSEAFFMQLDDMSSPPSPESTDSSPERDLPPTPSIPPAGGHQQDTSLAVAVIRREVSS
IHGEDTAQAPPRAQGPEERPGLQQEATGAAVVAGALGSRAVGAVPVGKEEGPPQPPLLRA
KALVKRVTWNLQEAQSGAPAEDPGLRMPLHRPQKPREGVWETEDMGPSMGFQQAPFSEPP
PAGYALPESGFPEAEPSQVYTPNLPPAPALPVSLPPYTAAGQPAVQYILHGSLPLASCGV
PQSPAPGPPALPAVSEPAAYSSGTSNSEERAAAPRPAAEKAKNEEYMKKLQVQERAVEEV
KLAIKPFYQKREVLEDGHQWWKVRNRSGQAGYVPSNILDETRLEEAPPQQASLKYWGPAS
PTHKLPPSFAGNKDELIHHMDEVNDELIKKISHIKAQPQRHFRVERSQPAAVPLTYESGP
AEVRAWLEAKAFSARIVENLGILTGPQLFSLNKDELKKVCGEEGIRVYSQLTVQKAVLEK
QPGGSELEELISKFHSKTQRRLEDDS
Download sequence
Identical sequences M3YBQ8
ENSMPUP00000008765 ENSMPUP00000008765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]