SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008813 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008813
Domain Number 1 Region: 211-450
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-70
Family Nuclear receptor ligand-binding domain 0.000000000361
Further Details:      
 
Domain Number 2 Region: 7-92
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-31
Family Nuclear receptor 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008813   Gene: ENSMPUG00000008883   Transcript: ENSMPUT00000008957
Sequence length 459
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897043.1:216921:401493:-1 gene:ENSMPUG00000008883 transcript:ENSMPUT00000008957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALAR
VYGGGLSNGLGSLSGEAGGAYANGHVIDLPKSEGYYSVDSGQPSPDQSGLDMTGIKQIKQ
EPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQ
THTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQNDQILLLKSGCL
EVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIA
LFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKLIAKIPTITAVC
NLHGEKLQVFKQSHPDIVNTLFPPLYKELFNPDCATVCK
Download sequence
Identical sequences M3YBV6
ENSMPUP00000008813 ENSMPUP00000008813 XP_004769256.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]