SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008986 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008986
Domain Number 1 Region: 166-403,445-499
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.37e-62
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 2e-19
Family DEATH domain, DD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008986   Gene: ENSMPUG00000009059   Transcript: ENSMPUT00000009134
Sequence length 696
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897267.1:296018:303947:-1 gene:ENSMPUG00000009059 transcript:ENSMPUT00000009134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVSI
LTHLQLLRARDIITAWHPPAPLLPPSTSTPRPSSPPAPCEAKVPRPRKLSTSAATVPSPA
FPDSQTHSGAELGPVPSPASRQQPPPPYPAPSSTKPNPESPVSPLQGAQASPFCWPLSEI
SQGTHNFSEELKIGEGGFGCVYRAVMRNTPYAVKRLKEGADLPWVAVKQSFLTEVEQLSR
FRHPNIVDFAGYCAQSGFYCLVYGFLPNGSLEDRLHFQTQACPPLSWPQRLDILLGTARA
IQFLHQDSPSLIHGDIKSSNVLLDERLMPKLGDFGLARLSRFAGASPGQSSTVARTQTVR
GTLAYLPEDYVKTGRLAVDTDTFSFGVVVLETLAGQRAVRTHGARTKYLKDLVEEEAEEA
GVTLKSTRTTVQAGLATDAWATPIAVQICKKHLDPRPGPCPPELGLALGHLACCCLHRRA
KRRPPMTQVYESLEKLQAVVAGPVPEPDSAGRSPSSPQENSYISQPSSAPCGASPPEPRA
LPSGAPAQAPEWLQKGPNQPVESDESVSGLSAALHSWRLTPSCPPDPAWPGSAGQEATAW
APTPLGKASWTQESSWGSGPGLQLTAMEGSLLSSSVASQPPQIIINPARQKMVRKLALYE
DGVLDSLQLLSSGSLRGSGVGPQGRPGPEESDEFQS
Download sequence
Identical sequences M3YCC9
ENSMPUP00000008986 XP_012905554.1.14098 ENSMPUP00000008986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]