SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009086 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009086
Domain Number 1 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.54e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 328-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 34-94
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 217-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.83e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009086   Gene: ENSMPUG00000009163   Transcript: ENSMPUT00000009239
Sequence length 404
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897058.1:2948193:2958558:1 gene:ENSMPUG00000009163 transcript:ENSMPUT00000009239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTASVLPSQDPPLPPERYPGEKGTTSLFLKARSQDLMTFEDVAVEFTKWEWGQLDPAQ
KDLYRVVMLENFKNLASLGLPVAKPYVISQLEKGKEPCVLEGEISTDWEKRPKAKESVLN
QGISKEELHQIASVEKYIRDEFCFCKLKATCGCDDQLEIQPKIQARHLKGMPISHKSTTL
KIDHERSEFGRSLDLRSVLVNQRSVPIEGAYKCDTEFRQTSGRNNSQRSHPGKKPCKCNE
CGKSFHFQSELRRHQRCHTGEKPYECSECGRAFGHISSLIKHQRTHTGEKPYECSECGRA
FSQSSSLVLHYRFHTGEKPYKCNECGRAFGHTSSLIKHQRTHTGEKPYECRECGRTFSQS
SSLIVHYRFHTGEKPYKCNKCGRAFSQSSSLTQHYRXXXXXXXX
Download sequence
Identical sequences M3YCM9
ENSMPUP00000009086 ENSMPUP00000009086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]