SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009523 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009523
Domain Number 1 Region: 426-528
Classification Level Classification E-value
Superfamily PDZ domain-like 1.22e-23
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 209-318
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-18
Family PDZ domain 0.033
Further Details:      
 
Domain Number 3 Region: 698-808
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000077
Family Nucleotide and nucleoside kinases 0.0013
Further Details:      
 
Domain Number 4 Region: 529-601
Classification Level Classification E-value
Superfamily SH3-domain 0.000000299
Family SH3-domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009523
Domain Number - Region: 2-38
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00173
Family PDZ domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009523   Gene: ENSMPUG00000009600   Transcript: ENSMPUT00000009679
Sequence length 1112
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897043.1:4882938:4915729:-1 gene:ENSMPUG00000009600 transcript:ENSMPUT00000009679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNGTPMEDVLHSFAVQQLRKSGKIAAIVVKRPRKVQLAPPQGSPPIDEDDRAFEVMDEF
DGRSARSGYSERSRRSSHGGRSRSWEDSPERGCPHERARSRERERSRGRSLERGLDDDDY
RRARERSRGRSLERGLDHDDYGRARERSLGRGTDRAYDHYDQAYDRGYDRGYDRTYSPEA
EYGRRAQPDARYSAPRSRSREHLHSRSPSPELRGRPDHAGQSDSDRPIGVLLMKSKANEE
YGLRLGSQIFIKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQ
LVVLRDSKQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRQQYSDYDYHSSNEKLKER
PNSREDMQNRWSRMGATPTPFKAMGDTAAAVGTENSKEPRYQEEPPAPQPKAAPRTFLRP
SPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKV
NTQDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILACGRGDSFFIRSHFECEKE
TPQSLAFTRGEVFRVVDTLYDGKLGHWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRDN
AGDRADFWRMRGQRSGVKKNLRKSREDLTAVVSVSTKFPAYERVLLREAGFKRPVVLFGP
IADIALEKLANELPDLFQTAKTEPKDAGSEKSSGVVRLNTVRQIIEQDKHALLDVTPKAV
DLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLYDQANKLKKTCAHLFTATI
NLNSANDSWFGSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDRMSYLTAMGADYLSCDSRL
ISDFEDTDGEGGAYTDNELDEPAEEPPVSSITRSSEPVQHEESIRKPSPEPRAQMRRAAS
RDQLRDSSPPPAFKPEPPKAKIQNREESFDFSRSHEYKSNPSAIAGNEVSGASTKGCPPP
VAAKPALGRSILKPSTPVPPPESEEVGEGSEEQEGTPKSVLGKVKIFEKMDHKARLQRMQ
ELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGLSQHTSSRPPEPQKGPSRLYQDPRGSYG
SDAEEEEYRQQLSEHSKRGYYGQPSRYRDTEL
Download sequence
Identical sequences M3YDW6
ENSMPUP00000009523 ENSMPUP00000009523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]