SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009600 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009600
Domain Number 1 Region: 779-887
Classification Level Classification E-value
Superfamily Bromodomain 9.16e-34
Family Bromodomain 0.00084
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009600
Domain Number - Region: 64-121
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0068
Family Bacterial exopeptidase dimerisation domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009600   Gene: ENSMPUG00000009676   Transcript: ENSMPUT00000009756
Sequence length 951
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896911.1:16123639:16147151:1 gene:ENSMPUG00000009676 transcript:ENSMPUT00000009756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGTGKHKLLSTGPTEPWSIREKLCLASSVMRSGDQNWVSVSRAIKPFAEPGRPPDWFS
QKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQEKYR
RLKRDAELIQAGHMDSRLDELCNDIVMKKKLEEEEAEVKRKATDAAYQARQAVKTPPRRL
PTVMVRSPIDSASPGGDYPLGDLTATTMEEATSGVTPGTLPSTPVTSFPGIPDTLPPGSA
PLEAPMTPVTDDSPQKKMLGQKATPPPSPLLSELLKKGSLLPTSPRLVNESEMAVASGHL
NSTGVLLEVGGVLPMIHGGEMQQTPNTVAASPAASGAPTLSRLLEAGPTQFTTPLTSFTT
VASEPPVKLVPPPVESVSQATIVMMPALPAPSSAPDVSTPESVAPVSQPDTCVPMEAVGD
PHTVTVSMDSSEISMIINSIKEECFRSGVAEAPGGSKAPSIDGKEDLDLAEKMDIAVSYT
GEELDFETVGDIIAIIEDKVDDHPEVLDVAAVEAALSFCEENDDPQSLPGPWEHPIQQER
DKPVSLPAPEMTVKQERLDFEETENKGIHELVDIREPSVEIKMEPAESEQGISGPEIVAG
VVPATSMEPPELRSQDLDEEPRSIATGEIVEADVPSGKGDETPLTTVKTEASPESMLSPS
HGSNPIEDSLEAETQHKFEMSDSLKEESGTIFGSQIKDAPGEDEEEDGVSEAASLEEAKE
EDQGEGYLSEMDNEPPVSESDDGFSIHNATLQSHTLADSIPSSPASSQFSVCSEDQEAIQ
AQKIWKKAIMLVWRAAANHRYANVFLQPVTDDIAPGYHSIVQRPMDLSTIKKNIENGLIR
STAEFQRDIMLMFQNAVMYNSSDHDVYHMAVEMQRDVLEQIQQFLATQLIMQTSESGISA
KSLRGRDSTRKQDSSEKDSVPMGSPAFLLSLFDGGTRGRRCAIEADMKMKK
Download sequence
Identical sequences M3YE43
XP_004744941.1.14098 ENSMPUP00000009600 ENSMPUP00000009600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]