SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009647 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009647
Domain Number 1 Region: 786-973
Classification Level Classification E-value
Superfamily Sec7 domain 2.22e-64
Family Sec7 domain 0.00000725
Further Details:      
 
Domain Number 2 Region: 989-1120
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000201
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009647   Gene: ENSMPUG00000009723   Transcript: ENSMPUT00000009803
Sequence length 1520
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897280.1:149367:226085:-1 gene:ENSMPUG00000009723 transcript:ENSMPUT00000009803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSGPPGGPGSESPNRAVEYLLELNNIIESQQQLLETQRRRIEELEGQLDQLTQENRD
LREESQLHRGELHRDPHGARDSPGRESQYQNLRETQFHHRELRESQFHQAARDVGYPNRD
GAYQNREAVYRDKERDAAYPLQDTTGYPARERDVAQCHLHHENPALGRERGGRETGSAHP
GREKEAGYSAAVGVGPRPPRERGQMSRGASRSSSPGAGGGHSTSTSTSPATTLQRKSDGE
NSRTVRSTASHTLHQYCCPTQVLDSMKLTPSGRLAESSVEGEAPGSDLSTAVDSPGSQPP
YRLSQLPPTSSHMGGPPAGVGLPWAQRARLQPASVALRKQEEEEIKRSKALSDSYELSTD
LQDKKVEMLERKYGGSFLSRRAARTIQTAFRQYRMNKNFERLRSSASESRMSRRIILSNM
RMQFSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGSSVT
TSGEFSNDITELEDSFSKQVKSLAESIDEALNCHPSGPMSEEPGSAQLEKRESKEQQEDS
SATSFSDLPLYLDDPVPPPSPERLPSTEPPPQGRPEFWAPAPLPPVPPPVPPGTREDGAR
EEGTRRGPGCLECRDFRLRAAHLPLLTIEPPSDSSVDLSDRSDRGSVHRQLVYEADGCSP
HGTLKHKGPPGRAPIPHRHYPAPEGPAPAPPGPLPPAPNSGTGPSGVAGGRRLGKCEAAG
ENSDGGDNESLESSSNSNETINCSSGSSSRDSLREPPSTGLCKQTYQRETRHSWDSPAFN
NDVVQRRHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGEFLG
NRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQKVERLIEAFSQRYCVCN
PALVRQFRNPDTIFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRGVDNGEDIPRDL
LVGIYQRIQGRELRTNDDHVSQVQAVERMIVGKKPVLSLPHRRLVCCCQLYEVPDPNRPQ
RLGLHQREVFLFNDLLVVTKIFQKKKILVTYSFRQSFPLVEMHMQLFQNSYYQFGIKLLS
AVPGGERKVLIIFNAPSLQDRLRFTSDLRESIAEVQEMEKYRVESELEKQKGMMRPNASQ
PGGAKDSVNGTLARSSLEDTYGAGDGLKRGALSSSLRDLSDAGKRGRRNSVGSLDSTIEG
SVISSPRPHQRMPPPPPPPPPEEYKSQRPVSNSSSFLGSLFGSKRGKGPFQMPPPPTGQA
SASSSSASSTHHHHHHHHHGHSHGGLGVLPDGQSKLQALHAQYCQGPGPAPPPYLPPQQP
PLPPPPQQPPPLPQLGSIPPPPASAPPVGPHRHFHAHGPVPGPQHYTLGRPGRAPRRGAG
GHPQFAPHGRHPLHQPTSPLPLYSPAPQHPPAHKQGPKHFIFSHHPQMMPAAGATGGPGS
RPPGGSYSHPHHPQSPLSPHSPIPPHPSYPPLPPPSPHTPHSPLPPTSPHGPLHASGPPG
TANPPSTNPKAKPSRISTVV
Download sequence
Identical sequences M3YE90
ENSMPUP00000009647 XP_004781274.1.14098 ENSMPUP00000009647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]