SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009865 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009865
Domain Number 1 Region: 530-601
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000327
Family RUN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009865   Gene: ENSMPUG00000009940   Transcript: ENSMPUT00000010025
Sequence length 613
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:3152295:3159783:-1 gene:ENSMPUG00000009940 transcript:ENSMPUT00000010025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVEAAAEPVTVVAAVSPKAKNEEEEEEESLPPCEAVRWAPVGAVAEAAPGTAAFSEEA
ASEEPGAAPGSPPDSPGRTLRRLRAERRRLDSALLALSSHFAQVQFRLRQVVRGAPAEQQ
RLLRELEDFAFRGCPHVLGYGGPEDPASDDGDGLPGDRPRLRGENQSEQEKRERLETQRE
KQKELILQLKTQLDDLETFAYQEGNYDSLPQSVVLERQRVIIDELIKKLDMNLNEDISSL
STDELRQRVDAAVAQIVNPARVKEQLVEQLKTQIRDLEMFINFIQDEVGSPLQAESVPCE
CKAGGKTGSGSTRTGGSRLPPGNSQTKAEDVKKVQQSGLRLMQRALAVLQIFAVSQLGCA
TGQIPQTLWQRGQADGDYAPLLKRLEISVDRVRQLALRHQPHDHVITSASLQDLSLGGKD
ELTTAVRKELTVAVRDLLAHGLYAASPGMSLVMAPIACLLPAFSSAPEAMHPWELFVKYY
HAKNGRAYVESPARKLSQSFALPVTGGTVVTPKQSLLTAIHMVLTEHDPFKRSADSELKA
LVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSYMAHTGFESALNLLSRLSSLKFSLPVD
LAVRQLKNIKDAF
Download sequence
Identical sequences M3YEV8
XP_004772683.1.14098 ENSMPUP00000009865 ENSMPUP00000009865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]