SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010007 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010007
Domain Number 1 Region: 117-238
Classification Level Classification E-value
Superfamily Bromodomain 1.83e-34
Family Bromodomain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010007   Gene: ENSMPUG00000010082   Transcript: ENSMPUT00000010167
Sequence length 594
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897032.1:5780315:5798539:1 gene:ENSMPUG00000010082 transcript:ENSMPUT00000010167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRARPEHAGSSLSADYTDKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHERERH
REKKKKKKKKAEKEKHLDDEERRKRKEEKKRKREKEHGDTEGEAEDFDPGKKVEVEPPPD
RPVRACRTQPAEHESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDF
GTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAAL
LGSEDTAVEEPVPEVAPVQVETARKSKRPSREVISCMFEPEGNACSLTDSTAEEHVLALV
EHAADEARDRISRLLPGGKMGYLRKNGDGGLLYSVVNTAEPDADEEETHPVDLSSLSSKL
LPGFTTLGFKDERRGKVTFLSSATTALSTHNSVFGDLKSDETELLYSAYGDETGVQCALS
LQEFVKDAGSYSRKLVDDLLDQITGGDHSRLLFQLRQRRNVPAKPPDEVKAGDSLGDGGS
VLDFMSMKSYSDASLDISAIGSLGKVKKELDADDGHLNLDETAKLLQDLHEAQAERGGSR
PPSNLSSLSNTSPSDRDQHHLGSPSRLSVGEQPEVTHDPYEFLQSPEAAASAKS
Download sequence
Identical sequences M3YFA0
ENSMPUP00000010007 ENSMPUP00000010007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]