SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010041 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010041
Domain Number 1 Region: 44-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.06e-36
Family SCAN domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 657-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 461-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 405-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 600-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.94e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 702-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 166-225
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-18
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 9 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 507-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000225
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010041   Gene: ENSMPUG00000010118   Transcript: ENSMPUT00000010203
Sequence length 761
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897220.1:157404:170683:1 gene:ENSMPUG00000010118 transcript:ENSMPUT00000010203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASCKRMTSSSRAQVLLMWKPDKAQSGPHNIAKETLASRILRDTETCRQNFRNFPYPDL
AGPRKALNQLRELCLKWLRPEIHSKEQILELLVLEQFLTILPGEVRTWVKSQYPESSEEV
VTLVEDLTQILEEEAVPQNSALPQETPEEDSKGRPAFQAGWLNDLVTKESMTFKDVAVDI
TQEDWEIMRPVQKELYKTVTLQNYWNMVSLGLTVYRPTVIPLLEEPWMVIKEILEGPSPE
WKTEAQECTPVTNTSTLVKTGTQTVKLEEPYDYDERFERHASDTYRRIPMNERNFTLKSV
LSKEDDPMEECLSKYDIYRNTFEKHSNLIIQFGTQSDNRTMYDEGRATFNHVSYGIVHRK
IYPGEKPYKCNVCGKKFRKNPSFVKHQSTHTKEKSHECEECGKEFRHISSLIAHQRMHTG
EKPYECHQCGKAFSQRAHLTIHQRIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKPY
RCLECGKTFSHSSSLINHQRVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCNE
CWKVFSQSTYLIRHQRIHSGEKCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICKICGKA
FSQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQG
ANLTQHQRIHTGEKPYKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLI
QHQRIHTGEKPYACRICGKTFTQSTNLIQHQRVHTGAKHHN
Download sequence
Identical sequences M3YFD4
XP_012905086.1.14098 XP_012905087.1.14098 ENSMPUP00000010041 ENSMPUP00000010041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]