SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010266 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010266
Domain Number 1 Region: 108-207
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-21
Family PDZ domain 0.0000265
Further Details:      
 
Domain Number 2 Region: 195-293
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000315
Family PDZ domain 0.0000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010266   Gene: ENSMPUG00000010339   Transcript: ENSMPUT00000010429
Sequence length 298
Comment pep:novel scaffold:MusPutFur1.0:GL897036.1:1254664:1271680:-1 gene:ENSMPUG00000010339 transcript:ENSMPUT00000010429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLYPSLEDLKVDKVIQAQTAFSANPGNPAILSEASAPISQDGNLYPKLYPELSQYMGLS
LNEEEIRANMAVVPGAPVQGQLVARPSSMNYMVAPVTGNDVGIRRAEIKQGIREVILCKD
QDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQ
AFGEKITMTVRDRPFERTVTMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICE
VNGQNVIGLKDSQIADILSTSETVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
Download sequence
Identical sequences M3YG09
ENSMPUP00000010266 ENSMPUP00000010266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]