SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010427 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010427
Domain Number 1 Region: 279-465
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-68
Family SPRY domain 0.0000000544
Further Details:      
 
Domain Number 2 Region: 6-87
Classification Level Classification E-value
Superfamily RING/U-box 1.02e-22
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 86-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.07e-17
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010427   Gene: ENSMPUG00000010504   Transcript: ENSMPUT00000010595
Sequence length 468
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897030.1:5202749:5216776:-1 gene:ENSMPUG00000010504 transcript:ENSMPUT00000010595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVAPLAMMWEEVTCPICLDPMVEPMSIDCGHNFCHECISEVGKDGGGVCPVCKHNFLL
QNLRPNWPLANMVDNLKQMAQSAKEDTQGDRCKVHGEKLHLFCEEDGKTLCWVCSQSQRH
RNHHMVPIEDAAREYQEKLQVALGKLRKGQEVAEEMEVNIATKRTAWKNQVETHKLRIHA
EFVQQKNFLATEEQRQLQRLDMEERNQLRILGEVEAMLAQKSQALQELVMELERRSRGSA
VELLQEVKNVLGRSESWNLKELNITSPDLRNVCLVPGLKRMLRTCGVHITLDPHTANPWL
ILSEDRRQVRLGDRRQEVPENEDRFDHYPMVLGAQCFDSGQVYWEVDVTGKEAWDLGVCR
DSVQRKGQFSLSPETGFWTIWLWNKQKYEAGTCIQTPLHLQVPPRQVGIFLDYEARIVSF
YNITDHGSLIYTFSECAFAEPLRPFFSTGFNDGGRNAAPLVLCPLEMG
Download sequence
Identical sequences M3YGH0
ENSMPUP00000010427 XP_004768252.1.14098 XP_004768253.1.14098 ENSMPUP00000010427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]