SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010441 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000010441
Domain Number - Region: 65-138
Classification Level Classification E-value
Superfamily LemA-like 0.0523
Family LemA-like 0.011
Further Details:      
 
Domain Number - Region: 155-257
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0931
Family Arfaptin, Rac-binding fragment 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010441   Gene: ENSMPUG00000010518   Transcript: ENSMPUT00000010609
Sequence length 370
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897129.1:2407032:2437358:1 gene:ENSMPUG00000010518 transcript:ENSMPUT00000010609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALMKLSDRTSLQMMTVGKEQQLTEKNSGFLQNMDAAQGAKQNLLRGFTKMDHILDRSDD
KDNTFSEKPQTAFLHETETTKWNMAELEAEHHRDQQNEWEEQETSQVQHEDPDMSTSLQF
SKENIPELTRENTFFQLNYWNSQMGLQVKELGADHIGWMEKINNIIRKINLTEDTMKRLL
NEVISLEGQIEKLESHQDLGADQGANIEEKIMEIKKQIEEMDNNYVQEDACNEAHELKEK
LIARMKNFYKDMTLISTKLGVYQMQEGKTDSQSPEEMVMEESERLLPQAPPPPSVQNSPA
RVTVWKRALRIFIMFYVLIFTGLSCYILFFDATFIFESLLPTMLGRRRMWELREIIAPFL
NLEVEDLLPS
Download sequence
Identical sequences M3YGI4
XP_012903282.1.14098 ENSMPUP00000010441 ENSMPUP00000010441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]