SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010620 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010620
Domain Number 1 Region: 228-295
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.72e-18
Family SAM (sterile alpha motif) domain 0.0000856
Further Details:      
 
Domain Number 2 Region: 149-217
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000774
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010620   Gene: ENSMPUG00000010703   Transcript: ENSMPUT00000010794
Sequence length 364
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897051.1:2446307:2477209:-1 gene:ENSMPUG00000010703 transcript:ENSMPUT00000010794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPKSRRNTINRSSSFGNFDRFRNNSISKPDDSTEVYEGEPINESGEHNKTSNNGGGLGKK
MRVISWTMKKKVGKKYVKALSEEKDEEDGETTLPYRNSDPVIGSHTEKVSLKASDSMDSL
YSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKG
DIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKAHRKTGKEKPKTLQEF
LEKIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIKNPEDRMRLLSAAENLLDEETIQ
EQEDESVPLSLSPDNSLNKSQLDDCPRDSGCYISSENSDNGKEDLESENLSDMVRKITIT
EPSD
Download sequence
Identical sequences M3YH13
ENSMPUP00000010620 ENSMPUP00000010620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]