SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010719 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010719
Domain Number 1 Region: 548-918
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.58e-132
Family Hect, E3 ligase catalytic domain 0.000000000000539
Further Details:      
 
Domain Number 2 Region: 17-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.33e-20
Family PLC-like (P variant) 0.00024
Further Details:      
 
Domain Number 3 Region: 449-491
Classification Level Classification E-value
Superfamily WW domain 0.000000000000011
Family WW domain 0.00047
Further Details:      
 
Domain Number 4 Region: 381-415
Classification Level Classification E-value
Superfamily WW domain 0.000000000000163
Family WW domain 0.0012
Further Details:      
 
Domain Number 5 Region: 347-381
Classification Level Classification E-value
Superfamily WW domain 0.00000000000135
Family WW domain 0.0016
Further Details:      
 
Domain Number 6 Region: 493-528
Classification Level Classification E-value
Superfamily WW domain 0.00000000000924
Family WW domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010719   Gene: ENSMPUG00000010807   Transcript: ENSMPUT00000010898
Sequence length 924
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897024.1:2550253:2630205:1 gene:ENSMPUG00000010807 transcript:ENSMPUT00000010898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAVYTEVIVDGEIKKTAKSSSSS
NPKWDEQLTVHVTPQSTLEFRVWSHYTLKADALLGRATIDLKQALLIHNRKLESVKEQLK
LSLENKNGIVQTGELTVVLDGLVIEQENLTNCSSSPTIEIQQNGDALHENGDPSTRPTSR
LAVEGTNGTDNHAPTSSLVQNSCCSYVVNGDSTPSSPSQVAARPKATPAPKPLTSEPAND
TVNGESSSSAPTDNASTTGTAIVSEENALSSNCTNTTVEDPPVQEILTSSENNECILSNS
AAFGSETRSTLDLAASNSGNNSAFEAAKLRQPDGCGEPVRQQSGSTNTETLPSGWEQRKD
PHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRNF
EQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTK
TTQWEDPRTQGLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQ
IAYERSFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIF
RGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFI
GRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGL
EMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGF
NEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDN
EVRMRLLQFVTGTCRLPLGGFAELMGLGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPP
YKSYEQLKEKLLFAIEETEGFGQE
Download sequence
Identical sequences M3YHB2
ENSMPUP00000010719 ENSMPUP00000010719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]