SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010749 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010749
Domain Number 1 Region: 246-420
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-63
Family SPRY domain 0.0000159
Further Details:      
 
Domain Number 2 Region: 32-105
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-18
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 111-170
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000534
Family B-box zinc-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010749   Gene: ENSMPUG00000010837   Transcript: ENSMPUT00000010928
Sequence length 422
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:11151358:11186624:1 gene:ENSMPUG00000010837 transcript:ENSMPUT00000010928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPSRPCSNIEPGNYEEVCDLITQIPSKVQIQDITKELHCPLCNDWFRDPLMLSCGHNF
CQACIQNFWKQQAKETFCPECKMLCQYSNCTFNLVLEKLVEKIKKLPLLKGHPQCPEHGE
NLKIFSKPDGKLICFQCKDARLSVGQSKDFLQISDAVHFFMKELTTHQDELEATLKELQS
LKNMQKDAIAAYKDISSLLDSLEQGTKVLMPRELISRKLNPGLYKGPIQYMMWREMQFSL
SPGLSSLTLDPKTAHPNLMLSKNRTSVWHGDIKQVMPDDPERFDSSVAVLGSKGFTSGKW
YWEVEVAKKTKWTVGVVRESIIRKGSCPLTPEQGFWLLRLRNQTDLKALDLPSCSLKLTN
NLNKVGIYLDYEGGQVSFYNAKTMTHIYTFTNNFTEKLYPYFCPCLNDGGENKEPLHILH
PQ
Download sequence
Identical sequences M3YHE2
ENSMPUP00000010749 ENSMPUP00000010749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]