SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000010994 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000010994
Domain Number 1 Region: 36-276
Classification Level Classification E-value
Superfamily Caspase-like 2.24e-92
Family Caspase catalytic domain 0.000000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000010994   Gene: ENSMPUG00000011084   Transcript: ENSMPUT00000011178
Sequence length 277
Comment pep:known scaffold:MusPutFur1.0:GL896957.1:3286424:3313243:-1 gene:ENSMPUG00000011084 transcript:ENSMPUT00000011178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSEHTVDAKSIKNSETKILHGSKSVDSGMSLDNSYKMDYPEMGLCIIINNKNFHRSTG
MAPRSGTDVDAANLRETFTNLKYEVRNKNDLTCEEILELMDSVSKEDHSKRSSFVCVLLS
HGDEGIIFGTNGPVDLKKLTGFFRGDYCRSLTGKPKLFIIQACRGTDLDCGIETDSGAED
DMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCTMLKLYAHKLEFMHILTRVN
RKVATEFESFSLDSAFHGKKQIPCIVSMLTKELYLYH
Download sequence
Identical sequences M3YI37
ENSMPUP00000010994 XP_004757778.1.14098 ENSMPUP00000010994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]