SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011127 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011127
Domain Number 1 Region: 7-90
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-23
Family PDZ domain 0.0000166
Further Details:      
 
Domain Number 2 Region: 317-346
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000228
Family LIM domain 0.00075
Further Details:      
 
Domain Number 3 Region: 285-316
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000131
Family LIM domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011127   Gene: ENSMPUG00000011219   Transcript: ENSMPUT00000011314
Sequence length 362
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896957.1:4044941:4076910:-1 gene:ENSMPUG00000011219 transcript:ENSMPUT00000011314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQNVVLPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESM
THADAQDRIKAAAHQLCLKIDRAETRLWSPQVSEDGKAHPFKINLESEPQDVNYFEHKHN
IRPKPFIIPGRSSGCSTPSGIDGGSGRSTPSSVSTLSTICPGDLKVAAKMAPNIPLEMEL
PGVKIVHAQFNTPMQLYSDDNIMETLQGQVSTALGEAPSMSEPTASVPPQSDVYRMLHDN
RNEPTQPRQSGSFRVLQELVNDDDRPAGTRSVRAPITKAHGSAGSAQKMPLCDKCGSGIV
GAVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGELYCETHARARTRPPEGYDTVTLYP
KA
Download sequence
Identical sequences M3YIH0
XP_004757823.1.14098 ENSMPUP00000011127 ENSMPUP00000011127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]