SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011134 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011134
Domain Number 1 Region: 1115-1187
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-23
Family SH3-domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1179-1281
Classification Level Classification E-value
Superfamily SH3-domain 9.71e-21
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 1291-1351
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-18
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011134   Gene: ENSMPUG00000011226   Transcript: ENSMPUT00000011321
Sequence length 1352
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896957.1:4123989:4263598:-1 gene:ENSMPUG00000011226 transcript:ENSMPUT00000011321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLFSFSFCGGCGTSRWQTWSQNRTDSYTILIWVHFFRRKTEDFNSKPSKVKMNTDSGGC
ARKRAAMSVTITSVKRVQSSPNLLAAGRDSQSPDSAWRSYNDRNQETLNGDATYSSLAAK
GFRSVRPNLQEKKSPTQSQITVNGNSGGAVSPMSYYQRPFSPSAYSLPGSLNSSIIMQHG
RSLDSAESYPQHAQSLDGTMGSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIR
TTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNTPYTYNAGLYNSPYSAQSHPAAKTQTYRP
LSKSHSDNGTDVFKDASSPVPPPHVPPPPPPLRPRDRSSTEKHDWDPPDRKVDTRKFRSE
PRSIFEYEPGKSSILQHERPPPLPTTLTPVPKEPGRKPLSVSRDGEVTGSPSPPPRTGLP
IPSPCTPTLSPTLTDRINPDDIDLENEPWYKFFSELEFGRPPPKKALDYVQDHSSGVSNE
ASLYQSSIDRSLERPTSSASMASDFRKRRKSEPAVGPPRGLDPSASRTSPGRADLPGPGG
PVTKSFISSSPPSPSRAKGGDDICPSLYSYSGLNGNPSNELDYCNAYRQHLDVPRDSQRA
ITFKNGWQMARQNAEVWSSTEETVSPKIKSRSCDDLLNDDCDSFPDPKTKSESMGSLLCE
EDSKDSCPIAWASPYIQEGRSNGRSRLRHRSALNAPGFLKMYRKMHRINRKDLMASEVIC
SVKSRIMQYEKEQQHKGLLHGWSQSSTEEVPRDMVPTRISEFEKLIQKSKSMPNLGDEML
SPISLEAQQNGLCPKRRFSIESLLEEEGQSRHASHMQRSYEPQALVPIHIEVTSDEQPRA
HVEFSDSDQDGVVSDHSDYIHVEGSSFCSESDFDHFSFTSSESFYGSSHHHHHHHHHHHR
HLISSCKGRCPASYTRFTTMLKHERAKHENTEEPRRQEMDPGLSKLAFLVSPVPFRRKKN
STPKKQTEKAKCKASVFEALDSALKDICDQIKAEKRRGSLPDNSILHRLISELLPDIPER
NSSLRALRRSPMHQPFHPLPQDGAMHRPLYQNDCGRMPHSASFQDADTTTASYRHQDYDS
ARSLQDHESPRSYASTMTDLGRSAPRERRGTPEKEKLPAKAVYDFKAQTSKELSFKKGDT
VYILRKIDQNWYEGEHHGRVGIFPISYVEKLIPPEKAQPARPPPPAQPGEIGEALAKYNF
SADTNVELSLRKGDRVILLKRVDQNWYEGKIPGTSRQGIFPVSYVEVVKKNPTTGADDYP
DPPIPHSYSSDRLHSLSSNKPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVI
DVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL
Download sequence
Identical sequences M3YIH7
ENSMPUP00000011134 ENSMPUP00000011134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]