SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011160 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011160
Domain Number 1 Region: 756-831,862-950
Classification Level Classification E-value
Superfamily RUN domain-like 8.5e-39
Family RUN domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1113-1290
Classification Level Classification E-value
Superfamily RUN domain-like 1.57e-28
Family RUN domain 0.013
Further Details:      
 
Domain Number 3 Region: 972-1055
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 4.32e-16
Family Lipoxigenase N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011160   Gene: ENSMPUG00000011251   Transcript: ENSMPUT00000011347
Sequence length 1296
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896948.1:2670356:2866746:-1 gene:ENSMPUG00000011251 transcript:ENSMPUT00000011347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSGAAPGPGSGSSPAACRFAHYFVLCGIDADSGLEPDELAVLYQWLEADRHGKSQDAA
NTTSGENFDQSPLRRTFKSKVLAHYPENIEWNPFDQDAVNMLCMPKGLSFRTQTDNKDPQ
FHSFIITREDGSRTYGFVLTFYEEVTSKQICTAMQTLYQMHNAEHYSSVYASSSCSMDSL
ASSIDEGDTTSLLKLQRYNSYDISRDTLYVSKSICLITPLPFMQACKKFLIQLYKAVTSQ
QPPPLPLESYIHNILYEVPLPPPGRSLKFYGVYEPVICQRPGPSELPLSDYPLREAFELL
GLENLVQVFTCVLLEMQILLYSQDYQRLMTVAEGITTLLFPFQWQHVYVPILPASLLHFL
DAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIELPEEFPQFPNKMDFIQELSE
VLLQFGIPPEGNLHCSESATKLKNLVLKDLVNDKKNGNVSTNNISMYELLKGNETIARLQ
ALAKRTGVTVEKMDLSATLSEKEKDLKLQCEEAELRDYQLNVQLREVFANRFTQMFADYE
AFVIQTAQDMESWLTNREQMQNFDKASFLSDQPEPYLPFLSRFIETQMFATFIDNKIMSQ
WEEKDSLLRVFDSRIEKMRLYNVRAPTLRTSIYQKCSTLKEAAQSIEQRLMKMDHTAIHP
HLLDMKIGQGKYEQGFFPKLQSDVLATGPTNNNRWVSRSATAQRRKDRLRQHSEHIGLDN
DLREKYMQEARSLGKNLRQPKLSDLSPAVIAQTNCKFVEGLLKECRMKTKRMLVEKMGHE
AVELGHGEANITGLEENTLIASLCDLLERIWSHGLQIKQGKSALWSHLIQFQDREEKQEH
LAESPVALGPERRKSDSGVMLPTLRVSLIQDMRHIQNMSEIKTDVGRARAWIRLSLEKKL
LSQHLKQLLSNQPLTKKLYKRYAFLRCEEEREQFLYHLLSLNAVDYFCFTSVFTTIMIPY
RSVIIPIKKLSNAIITSNPWICVSGELGDTGVMQIPKNLLEMTFECQNLGKLTTVQIGHD
NSGLLAKWLVDCVMVRNEITGHTYRFPCGRWLGKGIDDGSLERILIGELMTSVADEDLVK
QCRTPPQQKSPTSARRLSITSLTGKTTKPNAGQIQEGIGEAVNNIVKHFHKPEKERGSLT
VLLCGENGLVVALEQVFHHGFKSARIFHKNVFIWDFIEKAVAYFETTDQILDNEDDVLIQ
KSSCRTFCHYVNAINTAPRNIGKDGKFQILVCLGTRDRLLPQWIPLLAECPAITRMYEES
ALLRDRMTVNSLIRILQTIQDFTIVLEGSLIKGVDV
Download sequence
Identical sequences M3YIK3
ENSMPUP00000011160 ENSMPUP00000011160 XP_012913298.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]