SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011258 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011258
Domain Number 1 Region: 322-384
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-19
Family LIM domain 0.0029
Further Details:      
 
Domain Number 2 Region: 263-325
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.69e-19
Family LIM domain 0.011
Further Details:      
 
Domain Number 3 Region: 381-443
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.68e-16
Family LIM domain 0.0062
Further Details:      
 
Domain Number 4 Region: 440-470
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000376
Family LIM domain 0.0098
Further Details:      
 
Domain Number 5 Region: 234-261
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000978
Family LIM domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011258   Gene: ENSMPUG00000011350   Transcript: ENSMPUT00000011446
Sequence length 470
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897085.1:42244:46626:-1 gene:ENSMPUG00000011350 transcript:ENSMPUT00000011446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHPGGLFPADALLSDLETTTSHMPRSGVPKERTPEPLTAPLPYGHQPQTGSGESSGASG
DKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQ
FPPSKETVGEQKEDQCEDKKRPSLPPSPSPVLPKPSATSATLELDRLMASLSDFRVQNHV
NQLPASGSAQPPEPSSVNEDSPSSPGPASKGSLDTMLGLLQSDLSRRGVPTQTKGLCGSC
NKPIAGQVVTALGRAWHPEHFICGGCSMALGGSSFFEKDGAPFCPECYFERFSPRCGLCN
QPIRHKMVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQG
PILDNYISALSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLP
VTGRCVSALGRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFVKLFG
Download sequence
Identical sequences M3YIV1
ENSMPUP00000011258 XP_004773853.1.14098 ENSMPUP00000011258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]