SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011305 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011305
Domain Number 1 Region: 275-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-41
Family SPRY domain 0.0001
Further Details:      
 
Domain Number 2 Region: 7-41
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000119
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011305   Gene: ENSMPUG00000011397   Transcript: ENSMPUT00000011493
Sequence length 471
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897085.1:289162:296095:-1 gene:ENSMPUG00000011397 transcript:ENSMPUT00000011493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLSPVATEPLRAPCREPPATQQTL
SFNFLAPRALGGWGKAPGEEEVAFLPHTPHTEPKRPSGSALYPSVGGHQAAFAFVALTKT
SAPQTQLPQQKLQLQEACMRKEKSAAVLEHQLLEVEETVRQFRGAVGDQLGKMRVFLAAL
EGSLDREAERVRSEAGVALRRELGSLNSYLEQLRQMEKVLEEVADKPQTEFLMKYCLVTS
RLQKILAESPPPARLDIQLPVISDDFKFQVWRKMFRALMPVTKDLTFDPSTAHPSLVLSP
SGRRVECSDQKAPPAGEDPCQFDKAVAVVARQLLSDGEHYWEVEVGDKPRWALGVIAAQA
SRRGRLHAVPSQGLWLIGLRDGKILEAHVEAKEPRALRPAERRPSRVGIYLSFADGVLSF
YDASDADALELLFAFHERLPGPVYPFFDVCWHDKGKNAQPLLLVGADGEEA
Download sequence
Identical sequences M3YIZ8
ENSMPUP00000011305 ENSMPUP00000011305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]