SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011384 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011384
Domain Number 1 Region: 38-483
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.67e-98
Family Integrin alpha N-terminal domain 0.000000000605
Further Details:      
 
Domain Number 2 Region: 784-1014
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-64
Family Integrin domains 0.00000436
Further Details:      
 
Domain Number 3 Region: 484-642
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-46
Family Integrin domains 0.0000145
Further Details:      
 
Domain Number 4 Region: 643-777
Classification Level Classification E-value
Superfamily Integrin domains 2.88e-36
Family Integrin domains 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011384   Gene: ENSMPUG00000011474   Transcript: ENSMPUT00000011572
Sequence length 1062
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896956.1:133785:313282:-1 gene:ENSMPUG00000011474 transcript:ENSMPUT00000011572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGARRGPRGSLAPPLAPLWCFSAALGVLWTPASQAFNLDVDKLTVYSGPEGSYFGYAV
DFHIPAARTASVLVGAPKANTTQPDIVEGGAVYYCPWPAEGSAQCRQIPFDNTNNRKIRV
NGTKEPIEFKSNQWFGATVKAHKGEVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSAY
AEYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASIADIIADYS
FKDILRKLAREKQTDVAPASYDDSYLGYSVAAGEFTGDSEQELVAGVPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVTVSDVNNDGMDDILIGAPLFMEREFESSPREVGQVY
LYLQVSALVFRDPQILAGTEVFGRFGSAVAHLGDLNQDGYNDIAIGAPFAGKDQRGKVLI
YNGNKDGLNTKPSQTLQGVWASQTIPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAVY
RARPVVTVDAQLLLNPMIINLENKTCQVPESLSPVACFSLRVCASVTGQSISNTVGLTAE
VHLDALKQKGAIKRTLFLDNHQSHRVFPLPIKRQKSLQCQDFVVYLRDETEFRDKLSPIN
ISLNYSLDESTFKEGLEVKPILNYYRENTVTQQAHILVDCGEDNVCIPDLKLSARPDKNQ
VIIGDENHLTLMINARNEGEGAYEAELFVMIPEEADYVGIERSNKGLRPLSCEYKMENIT
RMVVCDLGNPMVAGTNYSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSLQINI
TAVAQVEIRGVSHPPQIVLPIHNWEPEEEPRKEEGVGPLVEHIYELHNIGPSTISDTLLE
VGWPFSARDEFLLYIFHIQTLGPLQCQTNPDINPQDIKPAASPEDTPELSAFLRNSTIPH
LVRKRDVQMPEPHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAKTFLQR
KNDPYSLASLVSFKVKKMPYKDQPAKLPEGSIAIKTSIIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDDMNDREQLTDEKAAEA
Download sequence
Identical sequences M3YJ77
ENSMPUP00000011384 ENSMPUP00000011384 XP_004757621.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]