SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011398 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011398
Domain Number 1 Region: 176-450
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.14e-83
Family N-acetyl transferase, NAT 0.000000000527
Further Details:      
 
Domain Number 2 Region: 48-174
Classification Level Classification E-value
Superfamily Chromo domain-like 3.21e-40
Family Chromo barrel domain 0.000000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011398   Gene: ENSMPUG00000011488   Transcript: ENSMPUT00000011586
Sequence length 461
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897085.1:366406:376290:-1 gene:ENSMPUG00000011488 transcript:ENSMPUT00000011586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQGAAAAVAAATSGVAGEGEPGPGENAAVEGTAPPGRVSPPTPARGEPEVTVEIGETY
LCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQK
NSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDK
IHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEIY
RKSNISVYEVDGKDHKLLCQRLLLQELSLSAGRKAVFPGRDRFVWDSLPKRVTFLRSASL
VSYTSKQEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLG
KLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICV
TPKLVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
Download sequence
Identical sequences M3YJ91
ENSMPUP00000011398 ENSMPUP00000011398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]