SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011644 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011644
Domain Number 1 Region: 4-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.13e-20
Family Ribosomal protein L24e 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011644   Gene: ENSMPUG00000011738   Transcript: ENSMPUT00000011836
Sequence length 157
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897065.1:3098950:3104517:-1 gene:ENSMPUG00000011738 transcript:ENSMPUT00000011836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK
KGQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQ
ASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR
Download sequence
Identical sequences G1LAN3 M3YJY7 W5QAY7
ENSAMEP00000003956 ENSCPOP00000016020 ENSOARP00000019882 ENSMPUP00000011644 ENSCPOP00000016020 10141.ENSCPOP00000016020 9615.ENSCAFP00000014113 ENSSSCP00000012733 ENSSSCP00000012733 ENSMPUP00000011644 ENSAMEP00000003956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]