SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011731 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011731
Domain Number 1 Region: 6-176
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.14e-70
Family Cyclophilin (peptidylprolyl isomerase) 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011731   Gene: ENSMPUG00000011825   Transcript: ENSMPUT00000011924
Sequence length 1463
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896941.1:1976098:2030290:1 gene:ENSMPUG00000011825 transcript:ENSMPUT00000011924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYK
GSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNG
SQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKS
TKDVFEKKRKKPTHSEDSDSSSNSSSSSESSSESEIEHERSRRRKHKRRPKVKHSKKRRK
EASSSEEPRTKHIMSPKGHSERSYTNEKRSVDSNAKREKPVVRPEEIPPVPENRFLLRRD
MPLVTVEPEPKIPDVTPIVSDQKPSVSKSGRKIKGRGTIRYHTPPRSRSCSESDDDDSSE
TPPHWKEEMQRLRAYRPPSGEKWSKGDKLSDPCSSRWDERSLSQRSRSWSYNGYYSDLST
ARHSDSHHKKRRKEKKVKHKKKAKKQKHCRRHKQTKKRRIIVPSDIESSKSSTRRMKSSC
DRERRSRSSSLSSHHSSKRDWSKSDKDDQSSSTHSSRDSYKSKSHSQSYSRGSSRSRTPS
KSSSHSRSRSKSRSTSKSGHQRTASKSPRRTTSQISENKPVKTEPLRATVPQNENVVVQP
VVAENIPVIPLSDSPPPSRWKPGQKPWKPSYERIQEMKAKTTHLLPLQSTYSLANIKETG
SSSSYHKREKNSESDRSAYSKYSDRSSESSPRSRSRSSRSRSYSRSYTRSRSLASSRSRS
RSASSRSHSRNKYSDHSQCSRSSSYSSVSSDDGRRAKRKFRSSGKKKNTSNKRHSSSSEK
RLRNKYVKSRDKCSSQRKYSESRSSLDYSSDSERSSVQVTQSAQEKERRVQMEMHSKQEK
NRDKEKSKPEQECSRSKKRASKDNLSDHLRNGSKPKRKNYAGSKWDSESNSERDVTKNSQ
SISRQSSDKEEGEATSDSESDFGEIHSKAKPPKKSSAGTSLPDGNGAWKSSKQRSSTSDS
DGSYSNSENTRRKARKHKHGSKENLKREQTKKAKEKLKGKKDKKHKAPKRKQAFHWQPPL
EFGEEEEEEEMSEKQVTQEPKEKKQVSENSETVKENTPHPEKSCEEGILSGKRNPVMTSS
DTDQPPKEDGKLGTSPTAFSPEELAASPSSIQHVAEGVPGGLEDILQTDDNMDICTPDRS
SPAKEASPQGPSRLAAPDVNIVLKQDVHTEPPETEEVKQESSTSESKMMGDVGKRDSSPA
SLACTVESTLKREGAEKSQLGVLDNKWKPLQGVGNLPVPVTPTSSAVEVKALTAAPEMKP
QGLRIEIKSKNKVRPGSLFDEVRKTARLNRRPRNQESSSEEQTPSRDGDSQSRSPSRSRS
KSETKSRHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRSYKS
HRTSSRSRSRSSSYDPHSRSRSYTYDSYYSRSRSRSRSQRSDSYHRGRSYNRRSRSCRSY
GSDSESDRSYSHHRSPSESSTYS
Download sequence
Identical sequences M3YK74
XP_004754311.1.14098 ENSMPUP00000011731 ENSMPUP00000011731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]