SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011843 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000011843
Domain Number - Region: 42-74
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0741
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011843   Gene: ENSMPUG00000011934   Transcript: ENSMPUT00000012037
Sequence length 199
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:621158:627686:-1 gene:ENSMPUG00000011934 transcript:ENSMPUT00000012037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNGAEADDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTIL
LQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASASELPSGSRPAPQPPVP
RPEHCEGAAAGLKAAQGPPPPVVPPNADVLACTQEALLQKLTWASAELGPSTSLETSIQL
CSLIRACAEALRSLRQLQH
Download sequence
Identical sequences M3YKI6
ENSMPUP00000011843 XP_004770098.1.14098 ENSMPUP00000011843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]