SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011960 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011960
Domain Number 1 Region: 246-421
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-28
Family Kelch motif 0.016
Further Details:      
 
Domain Number 2 Region: 74-232
Classification Level Classification E-value
Superfamily Kelch motif 7.85e-25
Family Kelch motif 0.035
Further Details:      
 
Domain Number 3 Region: 422-470,703-849
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-23
Family Fibronectin type III 0.00000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011960   Gene: ENSMPUG00000012052   Transcript: ENSMPUT00000012155
Sequence length 896
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:4948270:4995829:1 gene:ENSMPUG00000012052 transcript:ENSMPUT00000012155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGEGGAPLPGRLDSPRASNLAPGAGGHVTPTPGAQLEARPRPPPGAAALERARCIVGR
GAGVGKMAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNT
VTNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVK
PHPPSSGLPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGV
VGWSIPVTKGIVPSPRESHTAVIYCKKDSGSPKMYVFGGMCGARLDDLWQLDLETMSWSK
PETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENIETSPHDCEWRCTSSFSYLNLDTA
EWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDT
EKPPAPSQVQLIKATTNSFHVKWDEVPTVEGYLLQLNTDLPYQAASSDSTATPNMQGVRM
DPHRQGSNSTIPNSISDTMNSTKTEYTAMKGTSVKNRPDLKASTDSNATLHSSLATNASN
HNSCVVDVLRKNEGPHTSATIGVLSSCLDLRTVIPETSVSSSVSSAQTMVTQQTIKTESS
STNGAVVKDETSLTTFSTKSEVDEACALPASKISRVEAHATVMPFSKETPSNPVATMKAG
ERQWCDVGIFKNNTALVSQFYLLPKGKQSISKIGNADAPDYSLLKKQDLVPGTGYRFRVA
AINGCGIGPFSKISEFKTCIPGFPGAPSAVRISKNVEGIHLSWEPPTSPSGNILEYSAYL
AIRTAQIQDNPSQLVFMRIYCGLKTSCIVTAGQLANAHIDYTSRPAIVFRISAKNEKGYG
PATQVRWLQEKESDKDQVLLSVLYRYIAWIEWKLLQKYTNVEIPKALKFCVSVNLT
Download sequence
Identical sequences M3YKV3
ENSMPUP00000011960 ENSMPUP00000011960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]