SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012170 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012170
Domain Number 1 Region: 78-310
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.83e-38
Family PhyH-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012170   Gene: ENSMPUG00000012267   Transcript: ENSMPUT00000012370
Sequence length 499
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896943.1:7553927:7555525:1 gene:ENSMPUG00000012267 transcript:ENSMPUT00000012370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMKSKASCAQNPSCTIMIFHPTKEEFNDFDKYIAYMESQGAHRAGLAKVIPPKEWRAR
PTYDDISDILIATPLQQVVSGQAGVFTQYHKKKKAMTVGEYRRLANSGKYQTPPHSGFED
LERKYWKTRLYDSPIYGADISGSLFDENTKEWNLGHLGTIQDLLEQECGVVIEGVNTPYL
YFGMWKTTFAWHTEDMDLYSINYLHFGEPKTWYAVPPEHGQRLERLAKELFPGSARACEA
FLRHKVALISPTVLKDNGIPFSRITQEAGEFMVTFPYGYHSGFNHGFNCAEAINFATPRW
IDYGKVASQCSCGEARVTFSMDAFVRILQPERYELWKRGQDRAAVDHTEPVAPGGPELSA
WREVRGPGRGTWSLRHLPPRRAPRSSSAAQCGAVPARPSGEPGPTGPQPPTPCAPGPRPS
PGRCGPGRRPREQGAQGAQGPSLQARAKRRILGGAGYPAPYSEAQPFPVDGGWVNKPAPL
SPGLRQAAEASVSGCAPVP
Download sequence
Identical sequences M3YLG3
ENSMPUP00000012170 ENSMPUP00000012170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]