SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012180 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012180
Domain Number 1 Region: 59-101
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000954
Family Chromo domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012180   Gene: ENSMPUG00000012277   Transcript: ENSMPUT00000012380
Sequence length 415
Comment pep:novel scaffold:MusPutFur1.0:GL896922.1:2460840:2464112:1 gene:ENSMPUG00000012277 transcript:ENSMPUT00000012380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVHALCAAFRAGVMRRARAFRGGISRIHLVHAFFACISCVLVMHFSPCTHAFSPLHPQG
RMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGPKPKTFLLKAQ
AKAKAKTYEFRSDSARGIRIPYPGRAPQDLASTSRAREGLRNMGLSPPGSSSSPSSTCRV
EPPRDRDRERERERERERERERERERGASRTEDKPSSPGDSSKKRGPKPRKELLDPSQRP
LGEASDGLGDYLKGRKLDEAPSGAGKFPAGHSVIQLARRQDSDLAQCGVANPSPAEATGK
LAVDTFPARVIKHRATFLEARGQGTMDPGGPRVRHGSGTPGSVGGLYRDMGAQGGRPSLI
ARIPVARILGDPEEESWSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR
Download sequence
Identical sequences M3YLH3
XP_004748818.1.14098 ENSMPUP00000012180 ENSMPUP00000012180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]