SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012184 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000012184
Domain Number - Region: 2-30
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0003
Family Chromo domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012184   Gene: ENSMPUG00000012281   Transcript: ENSMPUT00000012384
Sequence length 491
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:2471847:2476997:-1 gene:ENSMPUG00000012281 transcript:ENSMPUT00000012384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRHNSWEPEENILDPRLLLAFQKKEHEKEVQSRKRGKRPRGRPRKHTVVSCSRHSKLKEP
DAPSKSSSSSSSSTSSSTSSDEEDDSDLDAKRGPRGRETHPVPQKKAQILVAKPELKDPV
RKKRGRKPLPPEQKAARRPVSLAKALKAARKDLGAPAVKLPPPLSAPAAGLAALKAHAKE
VCGGPSAVATPENLASLMKGMAGSPSRGGISWQSSIVHYMNRMSQSQAQAASRLALKAQT
AGKCGLGLDLKVRTQKGGLGIGSPGSKVPKAPSSGAVEQKGGSAGGPPYVHSSSKGPAAC
LGPQPAPTQELSLQVLDLQSVKNGTAGVGMVARHATASKGVPAASPAAGKSVGGGPAGGS
GAAMPSDGSKSEKLPSRVTALPTSAGKRDCVRGSAAPGSQEGHTASGEGRKAALAAELSA
GEESSSDSDPGSASPPGAKQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESP
TSVGFFSLRHY
Download sequence
Identical sequences M3YLH7
ENSMPUP00000012184 ENSMPUP00000012184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]