SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012492 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012492
Domain Number 1 Region: 91-273
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.85e-75
Family T-box 0.000000727
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012492   Gene: ENSMPUG00000012586   Transcript: ENSMPUT00000012694
Sequence length 436
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897085.1:1272644:1276468:-1 gene:ENSMPUG00000012586 transcript:ENSMPUT00000012694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHPRELYPSLGTGYRLGPPQPGTDSSFPPALAEGYRYPDLDPPKLDCFLSGIEAAPCTL
GAAPPLPPLPPALGTEPAPPAPEALHALPGVSLSLENRELWKEFNSVGTEMIITKAGRRM
FPACRVSVTGLDPEARYLFLLDVVPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPA
TGAHWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGVASFR
FPETAFISVTAYQNPRITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPGAAEA
YGSGDAPGGPCDSTLGGDVRESDPEQAPAPREAAPAPAPLCGGSSAEAYLLHPAAFHGAP
SHLPTRNPSFPEAPDSGRPAPYSAAFLELQPGPGGSGYPAAAPPAPFASHFLQGGPFPLA
YPGPGAYLDVGSKPMY
Download sequence
Identical sequences M3YMD5
ENSMPUP00000012492 ENSMPUP00000012492 XP_004774006.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]