SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012624 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012624
Domain Number 1 Region: 710-786,820-909
Classification Level Classification E-value
Superfamily RUN domain-like 6.93e-36
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1069-1242
Classification Level Classification E-value
Superfamily RUN domain-like 2.35e-26
Family RUN domain 0.014
Further Details:      
 
Domain Number 3 Region: 917-1013
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.21e-18
Family Lipoxigenase N-terminal domain 0.035
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012624
Domain Number - Region: 596-669
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.0589
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012624   Gene: ENSMPUG00000012718   Transcript: ENSMPUT00000012827
Sequence length 1249
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896930.1:1039725:1135680:-1 gene:ENSMPUG00000012718 transcript:ENSMPUT00000012827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCQYIQASKARDGASPFISSTTEGENFEQTPLRRTFKSKVLARYPENVEWNPFDQDAVGM
LCMPKGLAFKTQADPREPQFHAFIITREDGSRTFGFALTFYEEVTSKQICSAMQTLYHMH
NAEYDVLHSPSVDGRDHGMEDGEGTPGTKLQRFNSYDISRDTLYVSKCICLITPMSFMKA
CRSVLEQLHQAVTSPQPPPLPLESYIYNVLYEVPLPPPGRSLKFSGVYGPIICQRPSTNE
LPLFDFPVKEVFELLGVENVFQLFTCALLEFQILLYSQHYQRLMTVAETITALMFPFQWQ
HVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDL
PQFPNKLEFVQEVSEILMAFGIPPEGNLHCSESASKLKRLRASELVSDKRNGNIAGSPLQ
SYELLKENETIARLQALVKRTGVSLEKLEVREDPSSNKDLKVQCDEEELRIYQLNIQIRE
VFANRFTQMFADYEVFVIQPSQDKESWFTNREQMQNFDKASFLSDQPEPYLPFLSRFLET
QMFASFIDNKIMCHDDDDKDPVLRVFDSRVDKIRLLNVRTPTLRTSMYQKCTTVDEAEKA
IELRLAKIDHTAIHPHLLDMKIGQGKYEPGFFPKLQSDVLSTGPASNKWTKRNAPAQWRR
KDRQKQHTEHLRLDNDQREKYIQEARNMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKEC
RNKTKRMLVEKMGREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALW
SHLLHYQENRQRKLTSGSLSTSGILFDSERRKSDASSVMSPLRISLIQDMRHIQNIGEIK
TDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFN
AVDYFCFTNVFTTILIPYHILIVPSKKLGGSMFTANPWICISGELGETQILQIPRNVLEM
TFECQNLGKLTTVQIGHDNSGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGIDDGSLE
RVLVGELLTSQPEVDERPCRTPPLQQSPSVIRRLVTISPNNKPKLNTGQIQESIGEAVNG
IVKHFHKPEKERGSLTLLLCGECGLVSALEQAFQHGFKSPRLFKNVFIWDFLEKAQTYYE
TLEQNELVPEENWHTRARNFCRFVTAINNTPRNIGKDGKFQMLVCLGARDHLLHHWIALL
ADCPITAHMYEDVALIKDHTLVNSLIRVLQTLQEFNITLETSLVKGIDI
Download sequence
Identical sequences M3YMR7
ENSMPUP00000012624 ENSMPUP00000012624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]