SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012730 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012730
Domain Number 1 Region: 362-652
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-69
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 94-157
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000149
Family LIM domain 0.00054
Further Details:      
 
Domain Number 3 Region: 211-293
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000184
Family PDZ domain 0.021
Further Details:      
 
Domain Number 4 Region: 151-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000271
Family LIM domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012730   Gene: ENSMPUG00000012826   Transcript: ENSMPUT00000012935
Sequence length 693
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897019.1:1265618:1312222:-1 gene:ENSMPUG00000012826 transcript:ENSMPUT00000012935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLDKCFPENLWRGKLCIYQSTGQPFHCKSINSVLLCMIRIPSCTSCYFGPLNSLVLCA
GEDTWKCRGCGDHVSPSQRRYRTVNEAWHSSCFRCSECQDSLTNWYYEKDGKLYCHKDYW
GKFGEFCHGCSLLMTGPVMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCH
NEVVLAPMFERLSTESVQDQLPYSVTHISMPATTEGRRGFSVSVERACSNYATTVQVKEV
NRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAINQTSQTLQLLIEHDPVSQRLD
QLRLDARLSPHMQNAAHSHTLSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPKEPLLF
SRDISRSESLRCSSSNSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRC
DEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSVDPFPW
QQKVQFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKKPPV
EKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEIIGQVYA
DPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCKLEPESRPAFSKLEDSFEALC
LYLGELGIPLPAELEELDHTVSMQYGLTRDSPT
Download sequence
Identical sequences M3YN23
ENSMPUP00000012730 ENSMPUP00000012730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]