SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012740 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012740
Domain Number 1 Region: 459-536,603-785
Classification Level Classification E-value
Superfamily RNI-like 2.75e-24
Family 28-residue LRR 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012740   Gene: ENSMPUG00000012838   Transcript: ENSMPUT00000012947
Sequence length 816
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:3262312:3279235:1 gene:ENSMPUG00000012838 transcript:ENSMPUT00000012947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEAWRARSCWFCEVAAATTMEATSREAAPAKSSASGPSAPPALFELCGRAVSAHMGV
LESGVWALPGPILQSILPLLNIYYLERIEETALKKGLSTQAIWRRLWDELMKTRPSSLES
VTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFSPLLHSSRHVRQLTICNMLQGATELV
AEPNRRVLETLASSLHTLKFRHLLFSDVAAQQSLRQLLHQLIHHGAVSQVSLYSWPVPES
ALFILILTMSAGFWQPGPGGPPCRLCGEASRGRAPSRDEGSLLLGSRRPRRDAAERCAAA
LMASRRKSEAKQIARAAPATRVTRRSTQESLTAGGTDPKRDLHPPATSHEAPGTKRPSSA
PATSSSASASSSTSSSKRAPASSAPQPKPLKRFKRATGKKGPRTRQGSGAESEDLYDFVF
IVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRFRSISTLELFTVPLSTEAAL
TLCHLLSSWVSLESLTLSYNAIGLGSNIFRLLDSLRALSGQAGCRLRALHLSDLFSPLPI
LELTRAIVRALPLLRVLSIRVDHPSQRDNPAVPGNAGPPSHIIGDEEIPENCLEQLEMGF
PRGAQPAPLLCSVLKASGSLQQLSLDSATFASPQDFGLVLQTLKEYNLALKRLSFHDMNL
ADCQSEVLFLLQNLTLQEITFSFCRLFEKRPAQFLPEMVAAMKGNSTLKGLRLPGNRLGN
AGLLALADVFSEDSSSSLCQLDISSNCIKPDGLLEFAKRLERWGRGAFGHLRLFQNWLDQ
DAVTAREAIRRLRATCHVVSDSWDSSQAFADYVSTM
Download sequence
Identical sequences M3YN33
ENSMPUP00000012740 ENSMPUP00000012740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]