SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012789 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012789
Domain Number 1 Region: 50-138
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-34
Family SCAN domain 0.00015
Further Details:      
 
Domain Number 2 Region: 222-282
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.23e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 754-805
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-19
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 671-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 828-879
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-16
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 969-1021
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.7e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 588-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000189
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 9 Region: 857-913
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000289
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 528-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000754
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 11 Region: 437-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000715
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012789   Gene: ENSMPUG00000012887   Transcript: ENSMPUT00000012996
Sequence length 1024
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897089.1:229698:265241:1 gene:ENSMPUG00000012887 transcript:ENSMPUT00000012996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWYAVHPAQAQPSRERGRLQIKKEEEDEGYTSVQAARPQTLNRSGQELFRQLFRQL
RYHESSGPLETFSRLRELCRWWLRPDILSKAQILELLVLEQFLSILPGELRTWVQLHHPE
SGGEAVALLEELQRDINGTPWQDPALAQSPDVHWMGTGALRASQIWPSASPLRSGSTLGD
HLEPPYEIGVCDFLAGQSEPPVPQVPALSQREVCPGDPLTSQAQEAVTFKDVEVTFSQDE
WGWLDPAQRNLYRDVMLENYRNVVSLVGPFTKPVLISWLEAREPWGLNVQGAQPKGNPGV
APAGGELQIKTSKFLKHEPLEEGETLAMPSESWVMSVPEGMGLRESFELKSRLKEQYGNP
IQVRVKKEETNFSHRREKESEESGRSTSCNLKHGTCLRVPRRKRSLKHGCGRHFRGSSYH
YDYKEYGKGLRRIVGGFSLHQRIHAGLKANVKDACGKDFSLSSHHQHGQNLHMVATSYKC
SDCGRTFSHSSHLACHQRLHTQEKPFKCRVCGKAFRWSSNCVRHEKIHTGVKPYKCSLCD
KAFRRMSAYRLHQETHTKQKFLESNQYEEALTYGSGFDHHLRDQRGEKPFDCSQCRKSFH
CKSYVVEHQRVHTQEKPYKCTKCRKTFRWRSNFTRHMRMHQEEKFCDQDICREDFRQTSS
CSQPQNAPATEKAFPCQQCGKTFTRKKSLIDHQRIHTGEKPYRCSECEKEFTHRSAFIAH
KKQHAIQRKPEDGPSFSQDRVLQVPQSSHTTEEAYKCSQCGKAFRNHSFLLIHQRIHTRE
KPYKCRECGKAFRWSSNLSRHQRIHSLEKQYEYRESGNMPNLQPQILTGEKPFWCQECGK
TFTRKRSLLDHKGIHSGEKRYKCNLCGKSYDRKHRLVNHQRIHTKERPFKCQWCGKDFIG
RHTLCIHQRKHTRVAQSECSLAGLSSCQDAGVSLQELKTSGEKPLEDSEEACDQSSRITG
LQNIPIGKKCHKCSTCGKTFNKSSQLISHKRFHTRERPFKCRECGKTFRWSSNLARHMKN
HIRD
Download sequence
Identical sequences M3YN82
ENSMPUP00000012789 ENSMPUP00000012789 XP_004774210.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]