SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012865 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012865
Domain Number 1 Region: 536-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 494-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000366
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 259-387
Classification Level Classification E-value
Superfamily SET domain 0.0000000000687
Family Histone lysine methyltransferases 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012865   Gene: ENSMPUG00000012965   Transcript: ENSMPUT00000013074
Sequence length 608
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896977.1:7504810:7605253:-1 gene:ENSMPUG00000012965 transcript:ENSMPUT00000013074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKPGDPGGSAFLKVDPAYLQHWQQLFPHGGSGGPLYEGGGDMGWGWRPGACTPVWEPPA
AAPCLPPGSGPRQPRARAQSAHAATSRRHSRGASPAGIDGRPPRRARPAGLGATTSPAVG
TVPLFHPWPEQAPSRTPVPVCPHWPVSDVLEATGQATVTLCSGAGTRGWQGRGAEGTRER
REEAERDTPQGVESRPWGILSESHTIHTQLSCDMCADNRNGECPMHGPLHSLRRLVGTSS
AAAAAPPPELPEWLRDLPREVCLCTSTVPGLAYGICAAQRIQQGTWIGPFQGVLLPPEKV
QAGAVRNTQHLWEIYDQDGTLQHFIDGGEPSKSSWMRYIRCARHCGEQNLTVVQYRSNIF
YRACIDIPRGTELLVWYNDSYTSFFGIPLQCIAQDENLNVPSTVMEAMCRQDVLQPFSKS
GKLPPATQPRSVVFPQTPCTRNFSLLDKSGPMESGFNQINVKNQRVLASPTSTSQLHSEF
SDWHLWKCGQCFKTFTQRILLQMHVCTQNPDRPYQCGHCSQSFSQPSELRNHVVTHSSDR
PFKCGYCGRAFAGATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITE
SPESIEVD
Download sequence
Identical sequences M3YNF8
ENSMPUP00000012865 ENSMPUP00000012865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]