SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012966 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012966
Domain Number 1 Region: 2-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.77e-64
Family IMD domain 0.0000304
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012966
Domain Number - Region: 374-408
Classification Level Classification E-value
Superfamily SH3-domain 0.00965
Family SH3-domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012966   Gene: ENSMPUG00000013062   Transcript: ENSMPUT00000013175
Sequence length 523
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:12492550:12516571:-1 gene:ENSMPUG00000013062 transcript:ENSMPUT00000013175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEMDQFYRSTMAIYKSITDQFNPALENLVYLGNNYLRAFHALSQAAEVYFNAIQKIGE
QALQSSTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGDLLQHMEKNTKLDMQFIKDSRQ
HYEREYHHRATNLEKYMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEE
KRRYRFLAEKHLLLSNTFLQFFGRARGVLQNRVLLWKEQSEASRSPSRAHSPGLLGPVLG
PPYPSGRLTPTRLDMPPRPLAEFSSPRSRHGAGSSQAEFQSGAGKSLQDCKLGLVLTPGG
EAGGGEEESTGAHEGDRKDGGGGQWAGHSRPFLVRAEVKHKEMVLFPGAALGSAAVTTVS
GPFVYGPLCLHPLRSGWFPEAYVKPLEEVPVSPINPLNPVTSMNPMSPMNELPSRSYPLR
GSHSLDDLLDRPGNSTAPSEYWDGQSRSRTPTRIPSRAPSPAPTPLPDSRRSSMGSPGVA
SDVKKLMSWEQQPPELFPRGTNPFATVKLRPTVTNDRSAPLIR
Download sequence
Identical sequences M3YNQ9
ENSMPUP00000012966 ENSMPUP00000012966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]