SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012982 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012982
Domain Number 1 Region: 180-281
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 7.32e-42
Family HIN-200/IF120x domain 0.0000375
Further Details:      
 
Domain Number 2 Region: 282-369
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 1.52e-35
Family HIN-200/IF120x domain 0.0000459
Further Details:      
 
Domain Number 3 Region: 4-86
Classification Level Classification E-value
Superfamily DEATH domain 0.0000541
Family Pyrin domain, PYD 0.039
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012982
Domain Number - Region: 68-141
Classification Level Classification E-value
Superfamily OmpH-like 0.0484
Family OmpH-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012982   Gene: ENSMPUG00000013078   Transcript: ENSMPUT00000013191
Sequence length 411
Comment pep:novel scaffold:MusPutFur1.0:GL897121.1:994810:1005876:1 gene:ENSMPUG00000013078 transcript:ENSMPUT00000013191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDYKRIILLKGLEAINEYQFSIVKSLLARDLGLTANMQEEYNKVRIADLMEKKFPGPA
CVDKLIDLFKDMPPLKDIVKQLRNEKMKVAKKTKTEETPKKKQQQQGGAGAAPAAATTSS
RSSSALMGGTQEATAAAQKRKTAAWLPPPPAPAAAPVFPALPQSQTVKAPHQAAPRGRVL
QQGPLTVLVLKAMEPFEYESPEEGKTRMFHATVATPTQFFHVKVLNSSLKEKFTKENIIT
ILDYYECRGILEINKTSSVYQADPSQLIVVPNSIIKRASETPKIDNLYKQASGTFVYGLF
LLHEKKVNRKTTVYEIQDNTGTMEVVGTERWHDIKCERGDKLRLFCFQLKMIDQKLKLTC
GTHSFIQVVKAKKSKKDPVNFGVKVEFDMMNSPLDQFMGFNSGLVKTEDFY
Download sequence
Identical sequences M3YNS5
ENSMPUP00000012982 ENSMPUP00000012982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]