SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013019 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013019
Domain Number 1 Region: 1206-1310,1365-1505
Classification Level Classification E-value
Superfamily Cullin homology domain 9.16e-39
Family Cullin homology domain 0.0011
Further Details:      
 
Domain Number 2 Region: 805-961
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.98e-36
Family APC10-like 0.0055
Further Details:      
 
Domain Number 3 Region: 360-434
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.72e-32
Family CPH domain 0.00000674
Further Details:      
 
Domain Number 4 Region: 141-201,645-774
Classification Level Classification E-value
Superfamily ARM repeat 0.000000228
Family RPA1889-like 0.071
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013019
Domain Number - Region: 1536-1588
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0771
Family SCF ubiquitin ligase complex WHB domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013019   Gene: ENSMPUG00000013115   Transcript: ENSMPUT00000013228
Sequence length 1687
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:5371888:5387318:1 gene:ENSMPUG00000013115 transcript:ENSMPUT00000013228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDDGDGGSSQVDC
KAEHILLWMSNDEIYANCHKMLGEDGQVIGPSQEIAGEAGALDKSVLGEMETDVKALIQR
ALRQLEECVGTIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWS
AGRMIQALASHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLSEHPMSFEGI
QLPQVPGRLLFSLVKRYLHVTSLLDQLNDSTAEPGAQNSSSPEELSGERDRLELEFSMAM
GTLISELVQAMRWDWASSRQGPLARSSCSIFQPQLAEAGRGLPPTRAQPSIRRSRRFRPR
SEFASGNTYALYVRETLQPGMRVRMLDDYEEVSAGDEGEFRQSNNGVPPVQVLWESTGRT
YWVHWHMLEILGFEEDIEDVVEAEDYHRAVVSGALGIAVPSWRWKPMTELYAVPYVLPED
EDAEESEHLSQAEWWELLFFIKKLDGPDHQEVLQILQENLDGEVLDDEILAELAVPIELA
QDLLLALPQRLDDSALRDLLNCRVYRKYGPEALAGQPAYPTLLEAQAQPQESAGAAREEG
KEPPTQYPDTPLRRLMEGCGPPGRTFLDLEHALSSGGPQETEIKPFLLQLQRQPQPFLTL
MRSLATPAANKPLHLTVLRILMQLVDFPEAPLLPWHEAMDACMACLRSPDTDREVLQELI
FFLHRLASVSRDYAVVLNQLGARDAISKALEKHLGKLELAQELRDMVFKCEKHAHLYRKL
TTNILGGCIQMVLGQIEDHRRTHRPINIPFFDVFLRYLCQGSSVEVKEDKCWEKVEVSSN
PHRASKLTDRNPKTYWESNGSAGSHYITLHMHRGVLIRQLTLLVAGEDSSYMPARVVVFG
GDSPNSLNTELNSVNVMPSASRVVLLENLNRFWPVIQIRIKRCQQGGIDTRIRGLEVLGP
KPTFWPVFREQLCRHTRLFYMVRAQAWSQDIAEDRRSLLHLSSRLNGALRQEQNFADRFL
PDDEAAQALGKTCWEALVSPLVQNITSPDEDGISPLGWLLDQYLECREAAHNPQSRAAAF
SSRVRRLTHLLVHVEPCEAPPPAVAAPRPKGRNRSHDWSSLATRGLPSSIVRNLTRCWGA
VVEEQVNNFLTSHWRDDDFVPRYCEHFHNLQKSSSELFGPRAAFLLALHNGCAGGLLKLP
FLKAAHVSEQFARHIDQRIQGSRIGGARGMEMLAQLQRCLETVLIFSGLEIATTFEHYYQ
HYMADRLLSVGSSWLEGAVLEQIGPCFPNRLPQQMLRSLSTSEELQRQFHVYQLQRLDQQ
LLKLDDTEKKIQGGHEASDKEHKGEKADGPGVAAATGEEDEEEEEDEDLYYEGAMPEVSV
LVLSPRCWPIASIRHTLNPRTCLPSYLRGTVNQYSNFYSQSQSYPALERGPQRQLQWTWL
GRAELQFGDQTLHVSTVQMWLLLYLNDLKAVSVESLLALSGLSLDMLDQAIGPLTSSRGP
LDLEEQKDVPGRVLKIRDASEEPRPRRGNVWLIPPQTYLKAEDEEGRNLEKRRNLLNCLI
VRILKAHGDEGLHIDQLVCRVLDAWQKGPCPPRGLVSSLGKGSACGSTDVLSCVLHLLGK
GTVRRHDDRPHTLSYAVPVTVMEPHTESLNPGSSGPNPPLTFHTLQIRSRGVPYASCTGT
HSFSTFR
Download sequence
Identical sequences M3YNW2
ENSMPUP00000013019 XP_012917558.1.14098 ENSMPUP00000013019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]