SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013221 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013221
Domain Number 1 Region: 648-744
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.62e-22
Family PWWP domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013221   Gene: ENSMPUG00000013319   Transcript: ENSMPUT00000013432
Sequence length 755
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:19760515:19782798:1 gene:ENSMPUG00000013319 transcript:ENSMPUT00000013432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGAAEAAATAASPGEGGAGEAEPEMEPIPGSEAGTDPLPVTATEASVPDGEADGQQSS
PQADEPPLPPPPPPPGELARSPEAAGPELEAEEKLPARVAEPAAAAPQERPDLPPSPAPP
PEQPPAPEERQEPPLPQPAAPALVPPAGGDSAVSQLIPGSEVRVTLDHIIEDALVVSFRL
GEKLFSGVLMDLSKRFGPHGIPVTVFPKREYKEKPEAMQLQSNTFQEGTEVKCEVNGAVP
DDPSPISPPEPGLAESLWTSKPPPLFHEGAPYPPPLFIRDTYNQSIPQPPPRKIKRPKRK
MYREEPTSIMNAIKLRPRQVLCDKCKTGVVAEKKEIRKGSSASDSSKYEDKKRRNESVTT
VNKKLKTDHKVDGKNQNESQKRNAVVKVSNIAHSRGRVVKVSAQANTSKAQLSTKKVLQS
KNMDHAKAREVLKIAKEKAQKKQSETSTSKNAHSKVHFTRRYQSPSSGSLPPRVRLKPQR
YRNEENDSSLKTGLEKMRSGKMAPKPQSRCTSTRSAGEAPSENQSPSKGPEEASSEVQDT
NEVLVPGEQDEPQTLGKKGSKSNLSVYMTLNQKKSDSSSASVCSIDSTDDLKSSNSECSS
SESFDFPPGSMHAPSTSSTSSSSKEEKKLSNSLKMKVFSKNVSKCVTPDGRTICVGDIVW
AKIYGFPWWPARILTITVSRKDNGLLVRQEARISWFGSPTTSFLALSQLSPFLENFQSRF
NKKRKGLYRKAITEAAKAAKQLTPEVRALLTQFET
Download sequence
Identical sequences M3YPG3
XP_004737754.1.14098 ENSMPUP00000013221 ENSMPUP00000013221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]