SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013364 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013364
Domain Number 1 Region: 94-258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.07e-34
Family SPRY domain 0.005
Further Details:      
 
Domain Number 2 Region: 1247-1300
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000023
Family RING finger domain, C3HC4 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013364   Gene: ENSMPUG00000013466   Transcript: ENSMPUT00000013579
Sequence length 1315
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:979563:1005942:-1 gene:ENSMPUG00000013466 transcript:ENSMPUT00000013579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKGSSMSFSRKSYRLTSDAEKSRVTGIVHEKLLNDYLHRIFSSPEHAPAAAASRKPLN
FQNLPEHLDQLLHVEDEDEESQGQVEGRLGPSTVVLDHTGGFEGLLLVDDDLLGVIGHSN
FGTIRSTTCVYKGKWVYEVLISSQGLMQIGWCTINCRFNQEEGVGDTHNSYAYDGNRVRK
WNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLSRGLGMAYFPAISLS
FKESVAFNFGSRPLRYPFVAGYRPLQDPPRADLVRAQKLLGCFRAVLSVELDPVEGRLVE
KDSSEWQLQGQPTVLLTLAHIFHRFAPLLRKVYLVEAVLVSFLRGVVEAGSPAQAQAVVR
QVLDLLWLFMEDYEVQDCLKQLMMSLLRLYRFSPIVPDLGLQIHYLRLTIAILRHEKSRK
FLLSNVLFDVLRSVVFFYIKSPLRVEEAGLQELIPTTWWPHRSSREGKDSKDVKDETAEE
RVRRRAYERGCQRLKKRIEVVEELQVQILKLLLNNKDDNGGEASRYIFLTKFRKFLQENA
SGRGNMPVLCPPEYMVCFLHRLISALRYYWDEYKASNPRASFSEEAYIPPQVFYNGKVDY
FDLQRLGGLLSHLRKTLKDDLASKANILIDPLELQAATMDDLDEDEEPAPPAAQRPTQAL
AMGGVLPLPRPSWLSSPTLGRANRFLSTAAVSLMTPRRPLSTSEKVKVRTLSAEQRTRED
IEGSHWNEGLLLGRPPEEPEQPLTENSLLEVLDGAVMMYNLSVHQQLGKMVGVSDDVNEY
AIALRDTEDKLRRCPKRRKDIIAELTKSQKVFSEKLDHLSRRLAWVHATVYSQEKMLDIY
WLLRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTR
LAAILAKHFADTRIVGTDIRDSLMQALASYVCYPHSLRAVERIPEEQRVAMVRSLLAPYE
QRPWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPEDANLPSLQKPCPSTLLQQHMAELL
REGPDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQAAERLERNFVDSRQLKVCATCFDLSV
SLLRVLEMTITLVPEIFLDWARPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPG
LESVDHYPILVAVTGILVRLLVHGPASGTERATSVLLADPCFQLRSICYLLGQPEPPAPG
TALPAPDRKRFSLQSYTDYISAEELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYA
HPISAVFQPCGHKSCKACINQHLMNNKDCFFCKATIVSVEDWEKTASTSTTTSSA
Download sequence
Identical sequences M3YPV6
ENSMPUP00000013364 ENSMPUP00000013364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]