SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013426 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013426
Domain Number 1 Region: 251-325
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000392
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 886-971
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000785
Family Carboxypeptidase regulatory domain 0.027
Further Details:      
 
Domain Number 3 Region: 49-124
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000116
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 4 Region: 805-876
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000942
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013426
Domain Number - Region: 137-221
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00116
Family Rhamnogalacturonase B, RhgB, middle domain 0.023
Further Details:      
 
Domain Number - Region: 364-411
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00432
Family Carboxypeptidase regulatory domain 0.019
Further Details:      
 
Domain Number - Region: 732-790
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00785
Family Cna protein B-type domain 0.0094
Further Details:      
 
Domain Number - Region: 466-507
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0883
Family Rhamnogalacturonase B, RhgB, middle domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013426   Gene: ENSMPUG00000013529   Transcript: ENSMPUT00000013642
Sequence length 1144
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:3009661:3061881:-1 gene:ENSMPUG00000013529 transcript:ENSMPUT00000013642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPLYDKGDFILKIEPPLGWSFEPTNVELYVDGVSDICTKGGDINFVFTGFSVNGKVLSK
GQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGDYEILATHPTWALKEASTT
VRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSSVVSKEDVLGCNISPVPGF
QPQDESLVYLCYAVSKEDGSFSFYSLPSGDYTVIPFYRGERITFDVAPSRRDFTVEHDSL
KIEPVFHVMGFSVTGRVLNGPEGEGVPEAVVTLNNQIKVKTKADGSFRLENITTGTYTIH
AQKEHLYFETVTIKIAPNTPQLADIIATGFSVCGQISILRFPDTVKQMSKYKVVLSSQDK
DKSLVTVETDAHGSFCFKAKPGAYKVQVMVPEAETRAGLTLKPQTFPLAVTDRPVMDVAF
VQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKVNSMTFTFDNVLPGKYKIS
IMHEDWCWKNKSLEVEVLEDDVSTIEFRQTGYMLRCSLSHAITLEFYQDGNGPENVGIYN
LSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLTAIRHHVLGTITTDKMM
DVTVTIKSSIDSEPALVLGPLKSAQELRREQQLAEIESRRQEREKSGKQDVGEGRTKPPV
QEMVEELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSMEATVSGESCPGKLIEIHGK
AGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDRGAYSVGPLHSDLEYTVSSQKEGY
VLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGVFRSNLLTQDNGILTFSN
LSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITVTGYRTAYSCYGTVSSLNGEPEQGV
AVEAVGQNDCSIYGEDTVTDEDGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVITV
GNNDIDDVSIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFF
HFPPLLRDGQNYVVLLDSTLPRSQYDYVLPQVSFTAVGYHKHITLIFNPTRKLPEQDIAQ
GSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQTASDNSGPEDAKRQAKKQK
TRRT
Download sequence
Identical sequences M3YQ18
XP_012910579.1.14098 ENSMPUP00000013426 ENSMPUP00000013426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]