SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013491 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013491
Domain Number 1 Region: 228-297
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013491   Gene: ENSMPUG00000013594   Transcript: ENSMPUT00000013707
Sequence length 478
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:6544088:6552606:1 gene:ENSMPUG00000013594 transcript:ENSMPUT00000013707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQALGGPPTPAISTPVHFQ
SPPPVPGEVLKVQSYLENPTSYHLQQSRDQKVREYLSETYGNKFAAHISPAQGSPKPLPA
ASPGVRAGHVMSSSAGNSAPNSPMAMLHIGSNPEREFDVIDNIMCLDDVLGFINPETQMP
NTLPLSSSRLNVYSGDPQVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNHN
LIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENH
SRRLEMTNKQLLLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEALL
LEAEVPDPEPLPVLPPQAPLPLPAQPPQPPSPFHHLDFSHSLSFGGGGDEGPPGYPEPLG
PEHGSPFPNLSKKDLDLMLLDDSLLPLASDPLFSTMSPEASKASSRRSSFSMEEGDVL
Download sequence
Identical sequences M3YQ82
ENSMPUP00000013491 ENSMPUP00000013491 XP_004739991.1.14098 XP_012917853.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]