SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013526 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013526
Domain Number 1 Region: 635-745
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-24
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 458-569
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 3 Region: 752-817
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000148
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 287-395
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000497
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 5 Region: 811-873
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000709
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 6 Region: 879-938
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000121
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 399-460
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000167
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 574-638
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000944
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013526   Gene: ENSMPUG00000013630   Transcript: ENSMPUT00000013743
Sequence length 1031
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897019.1:5422224:5549115:-1 gene:ENSMPUG00000013630 transcript:ENSMPUT00000013743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKQKEQELTPLLPWLRGPVLPGSLTTDIFRPLDWDSALLAAPELMDASQEADIGPSGAS
LLPSRALGSSSLNKESLEERVTTAPLNPVQSGEDLREPGLEGEAPSAALSTRLPEETATK
HTLPSGKKLPSLKQVNSARKQLRPKVTSTAAVQRTVSSPASLGLGILSSSATEKPRPPGD
PEPAASEEPLWLDQKAGAVPTTPAPLQISPFTSQSYVAHTLPQRPDPGESAVPDDAPEAP
PEDASPITLMDKGENELTGSASEESQETTTSTIITTTVITTEQAPAPCSVSFSDPEGYID
SSDYPPLPLSGFLECTYNVTVYTGYGVELQVKSVNLSDGELLSIRGVDGPTLTVLANQTL
LVEGQVIRSPTNTISVYFRTFQDDVLGTFQLHYQAFMLSCNFPRRPDFGDVTVMDLHPGG
AAHFHCHLGYELQGAKTLTCMNASKPHWSSQEPICSAPCGGAVHNATIGRVLSPSYPGNT
NGSQFCVWTIEAPEGQKLHLHFERLSLHEKDRMMVYSGLINKSALLYDSLQTENVPFEGL
LSEGNSIRIEFTSDQARAASAFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTIVEFT
CDPGHSLEQGPAIIECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVEGED
CIWKIHVGEEKRIFLDIQFLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSSTPDL
TIQFHSDPTGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARITYQC
DPGYDIVGSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYT
CNPGFVLEGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLYLP
GESLTFMCYEGFELMGEVTIRCILGQPSHWNGPLPVCKVNQDSFEHALEVAEAAAETSLE
GGNMALAIFIPVLIISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYE
TGETREYEVSI
Download sequence
Identical sequences M3YQB7
ENSMPUP00000013526 ENSMPUP00000013526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]